PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G23230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 377aa    MW: 40369.1 Da    PI: 6.6572
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G23230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.58.1e-10172219552
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  LPERR07G23230.1 172 KRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 219
                      9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-14168232IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599170233IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.05E-10172223No hitNo description
PfamPF001709.1E-9172217IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.7E-8172217No hitNo description
CDDcd147031.24E-22173222No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MAMPPPKPGG DHPSPGRSPN LNLPCPPLPP IVPSPSPAPP PPPHHRRARS EVAFRFPEDL  60
GLGGGSGGDG ASFDEIGSED DLLFSTFMDM DKIAGGGADR DSRAAETSSP PRPTKHRHSA  120
SFDGFAFSAG APGTATKQQD GGGGVGFAAD VMEAKKAMSS EQLAELAAID PKRAKRILAN  180
RQSAARSKER KARYITELER KVQTLQTEAT TLSAQLTLFQ RDTTGLSAEN AELKIRLQAM  240
EQQAQLRDAL NDALKQEVER LKIATGEMTK SNEAYNTGMQ QVPYSPSFFQ LSEQHAVQHH  300
AGIQQLTHQF QQSHPSVPIH QMLSHPNSLS DMMQQDSLGR LQGLDIGKGP VAVKSEAEVV  360
VKSEGSSISA GESNSTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1025620.0AK102562.1 Oryza sativa Japonica Group cDNA clone:J033097I23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646776.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-138RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0D9X2Y50.0A0A0D9X2Y5_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g48180.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-79bZIP family protein